Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319846.1 | internal | 173 | 520-2(-) |
Amino Acid sequence : | |||
SKALLHSSHMFHEAQHSFANHGVEFSSVEVDLPAMMGQKDKAVYNLTRGIEGLFKKNKVNYVKGYGKFISPSEISVDTVEGGNSVVKGKNIIIATGSDVKGLPGITIDEKRIVSSTGALA LTEIPKRLVVIGAGYIGLEMGSVWGRLGSEVTVVEFGADIVPSMDGEVRKQFQ | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,550.063 | ||
Theoretical pI: | 6.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 22.264 | ||
aromaticity | 0.069 | ||
GRAVY | -0.020 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.277 | ||
sheet | 0.220 |