Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319852.1 | 5prime_partial | 196 | 597-7(-) |
Amino Acid sequence : | |||
IRRGLGGISLLKWSPSGDYLLSAKFDGTFYLWETNTWTSEPWLSTNGFVMGAAWDPDGSRILVAFSESSTLGSIHFATRPPSLDAHLIPVELPEIQSLTGSRGIDKIAWDGSGERLALSY RNGDDMCKGLIAIYDVRRSPLISASLVGFIRGPGDNPKPLAFSFHDKFKQGPLLSVCWSSGFCCTYPLIFRSHVLP* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,513.310 | ||
Theoretical pI: | 7.066 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 46200 | ||
Instability index: | 41.874 | ||
aromaticity | 0.117 | ||
GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.316 | ||
sheet | 0.214 |