Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319853.1 | internal | 193 | 580-2(-) |
Amino Acid sequence : | |||
ELPLEQKAKLYIEGEQLSNEEFFYWKDTLAHGCHPLHQDLINSWPEKPAKYREVVAKYSVEVRKLTMRMLDYICEGLGLKLGYFDNELSQIQMMLTNYYPPCPDPSSALGSGGHYDGNLI TLLQQDLPGLQQFIVKDATWIAVQPIPTAFVVNLGLTLKIISNEKFEGSIHRVVTDPTRDRVSIATLIGPDYS | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,872.819 | ||
Theoretical pI: | 5.199 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 30.392 | ||
aromaticity | 0.098 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.228 | ||
sheet | 0.259 |