Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319856.1	internal	191	575-3(-)
Amino Acid sequence :
ITRCPKNPFLENAMNFIVSNFSPNKSNSSPLWGSISLADNSAPVTESRTGMSFPSILKDTQRLLGIGLRKKAVFGLKNIDVYAYGVYADDSDVKQCLAEKHGEHSVSELKQKEELRNHLM ESDIRMTVRLQIVYGRLSIRPVRSAFEESVGTRLHKFAGYDNKELLERFTSQFKDDIKLPRGSIIELSRDH
Physicochemical properties
Number of amino acids:		191
Molecular weight:		21,647.413
Theoretical pI:		9.058
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		47.624
aromaticity		0.079
GRAVY		-0.471
Secondary Structure Fraction
Helix		0.298
turn		0.262
sheet		0.236