Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319858.1 | internal | 200 | 601-2(-) |
Amino Acid sequence : | |||
KGEAAKFELPLEQKAKLYVEGEQLSNEEFLYWKDTLAHGCHPLDQDLVNSWPEKPAKYREVVAKYSVEVRKLTMRMLDYICEGLGLKLGYFDNELSQIQMMLTNYYPPCPDPSSTLGSGG HYDGNLITLLQQDLPGLQQLIVKDATWIAVQPIPTAFVVNLGLTLKVITNEKFEGSIHRVVTDPTRDRVSIATLIGPDYS | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 22,516.547 | ||
Theoretical pI: | 5.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 24.676 | ||
aromaticity | 0.090 | ||
GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.220 | ||
sheet | 0.270 |