Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319861.1	internal	193	580-2(-)
Amino Acid sequence :
RAVHLDYLEAGADIILSSSYQATIQGFKAKGYSTEESESLLKRSVEIACEARDVYYNRCCESSSNRSTDGGVLKQRPILVAASIGSYGAYLADGSEYSGEYGGAIDLNFLKNFHRRRVQL LADSGADIIAFETVPNKLEAQAFVELLKEEDIKTPAWLSFNSKDGINVVSGDSLSECATIGESCEKVLAVGIN
Physicochemical properties
Number of amino acids:		193
Molecular weight:		20,893.086
Theoretical pI:		4.786
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18910 19160
Instability index:		44.527
aromaticity		0.083
GRAVY		-0.168
Secondary Structure Fraction
Helix		0.306
turn		0.254
sheet		0.285