Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319861.1 | internal | 193 | 580-2(-) |
Amino Acid sequence : | |||
RAVHLDYLEAGADIILSSSYQATIQGFKAKGYSTEESESLLKRSVEIACEARDVYYNRCCESSSNRSTDGGVLKQRPILVAASIGSYGAYLADGSEYSGEYGGAIDLNFLKNFHRRRVQL LADSGADIIAFETVPNKLEAQAFVELLKEEDIKTPAWLSFNSKDGINVVSGDSLSECATIGESCEKVLAVGIN | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 20,893.086 | ||
Theoretical pI: | 4.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 44.527 | ||
aromaticity | 0.083 | ||
GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.254 | ||
sheet | 0.285 |