Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319863.1	5prime_partial	127	420-37(-)
Amino Acid sequence :
ASGKGICNQSGNSQPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSRGEIRKT CRKINSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		13,877.475
Theoretical pI:		9.548
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4595
Instability index:		40.881
aromaticity		0.087
GRAVY		-0.506
Secondary Structure Fraction
Helix		0.252
turn		0.323
sheet		0.205