Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319871.1 | internal | 189 | 567-1(-) |
Amino Acid sequence : | |||
TALIESHVQAAVICAKELKVQLRVRSGGHDYEGISYTSEMKRSVPFILLDLAKLRTIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTSLGIGGHITGGAYGPMMRKYGLGA DNVVDARIVDASGRVLDRDLMGQDLFWAIRGGGGGSFGILLAWKIRLVPVPSTVTVFTVAKTLETGATK | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,239.149 | ||
Theoretical pI: | 9.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 28.232 | ||
aromaticity | 0.074 | ||
GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.222 | ||
sheet | 0.249 |