Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319871.1	internal	189	567-1(-)
Amino Acid sequence :
TALIESHVQAAVICAKELKVQLRVRSGGHDYEGISYTSEMKRSVPFILLDLAKLRTIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTSLGIGGHITGGAYGPMMRKYGLGA DNVVDARIVDASGRVLDRDLMGQDLFWAIRGGGGGSFGILLAWKIRLVPVPSTVTVFTVAKTLETGATK
Physicochemical properties
Number of amino acids:		189
Molecular weight:		20,239.149
Theoretical pI:		9.075
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 27055
Instability index:		28.232
aromaticity		0.074
GRAVY		0.099
Secondary Structure Fraction
Helix		0.328
turn		0.222
sheet		0.249