Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319875.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
HPTKEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHDDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVC INGMILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,158.832 | ||
Theoretical pI: | 6.067 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 40.862 | ||
aromaticity | 0.046 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.263 | ||
sheet | 0.263 |