Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319877.1 | internal | 140 | 421-2(-) |
Amino Acid sequence : | |||
EMASLISSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEK EYKPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,111.242 | ||
Theoretical pI: | 4.863 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 45.841 | ||
aromaticity | 0.100 | ||
GRAVY | -0.324 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.214 | ||
sheet | 0.264 |