Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319888.1 | internal | 111 | 334-2(-) |
Amino Acid sequence : | |||
APGGTKMARIWGRTGCKFNAAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNP | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,616.106 | ||
Theoretical pI: | 8.495 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18490 | ||
Instability index: | 41.728 | ||
aromaticity | 0.081 | ||
GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
Helix | 0.207 | ||
turn | 0.342 | ||
sheet | 0.180 |