Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319901.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
LTSASLRKTMASLVSSWAAQVNSVPERYVVPSQKRLNINVPIGKDIPVIDLSLPSQNIVDQIIKASQEYGLFQVINHGVSKELIGDVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNLD QKPKLFIEKEYKPKKNGKSDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 12,413.618 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 42.282 | ||
aromaticity | 0.222 | ||
GRAVY | 0.409 | ||
Secondary Structure Fraction | |||
Helix | 0.525 | ||
turn | 0.141 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319901.1 | complete | 99 | 2-301(+) |
Amino Acid sequence : | |||
MRKCIFPENYFFITLAILLRFIFFFNEKFWFLVQIWLKFTQLFFFISILLQFLNWQLEKLPTNFQNITNQLFRDSMVNHLKESILLRSFDDLINYILRR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 12,413.618 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 42.282 | ||
aromaticity | 0.222 | ||
GRAVY | 0.409 | ||
Secondary Structure Fraction | |||
Helix | 0.525 | ||
turn | 0.141 | ||
sheet | 0.242 |