Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319909.1	internal	121	364-2(-)
Amino Acid sequence :
RSDVAFGAIPYNNTKFNAWVAEGRAPAIPSILGVYKTVLFLGIKPVFITGTAEKFRNVRIANLKKVGYGNWAKLVLKGENDAASAVEFKSSKRTELVKAGYRIVGNIGDQWTDLIGQDVG A
Physicochemical properties
Number of amino acids:		121
Molecular weight:		13,129.956
Theoretical pI:		9.820
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		9.627
aromaticity		0.107
GRAVY		-0.036
Secondary Structure Fraction
Helix		0.347
turn		0.248
sheet		0.223