Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319909.1 | internal | 121 | 364-2(-) |
Amino Acid sequence : | |||
RSDVAFGAIPYNNTKFNAWVAEGRAPAIPSILGVYKTVLFLGIKPVFITGTAEKFRNVRIANLKKVGYGNWAKLVLKGENDAASAVEFKSSKRTELVKAGYRIVGNIGDQWTDLIGQDVG A | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,129.956 | ||
Theoretical pI: | 9.820 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 9.627 | ||
aromaticity | 0.107 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.248 | ||
sheet | 0.223 |