Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319912.1 | internal | 138 | 415-2(-) |
Amino Acid sequence : | |||
GRPGRCWAAQVNSVPERYVVPSQKRLNINVPIGKDIPVIDLSLPSQNIVDRIIKASREYGLFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKEY KPKKNDKEVIFWKDTFAH | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,997.203 | ||
Theoretical pI: | 5.798 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 42.756 | ||
aromaticity | 0.094 | ||
GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.217 | ||
sheet | 0.232 |