Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319915.1 | internal | 101 | 304-2(-) |
Amino Acid sequence : | |||
IGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,046.456 | ||
Theoretical pI: | 4.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 33.153 | ||
aromaticity | 0.129 | ||
GRAVY | 0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.198 | ||
sheet | 0.198 |