Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319916.1 | internal | 151 | 454-2(-) |
Amino Acid sequence : | |||
AKGLKLSGDGKDVWVFDIDETTLSNLPYYARSDVAFGAIPYNNTKFNAWVAEGRAPAIPSILGVYKTVLFLGIKPVFITGTAEKFRNVRIANLKKVGYGNWAKLVLKGENDAASAVEFKS SKRTELVKAGYRIVGNIGDQWTDLIGQDVGA | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,428.606 | ||
Theoretical pI: | 9.398 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 11.368 | ||
aromaticity | 0.113 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.245 | ||
sheet | 0.225 |