Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319917.1	internal	111	333-1(-)
Amino Acid sequence :
HFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMEKHGATGWLVNTGWSGGSYGSGNRIKLAYTRKIIDSIHSGALLKAEYKKTEVFGLEIPTELEG
Physicochemical properties
Number of amino acids:		111
Molecular weight:		11,929.515
Theoretical pI:		7.091
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		21.600
aromaticity		0.108
GRAVY		-0.048
Secondary Structure Fraction
Helix		0.288
turn		0.234
sheet		0.306