Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319923.1 | internal | 177 | 533-3(-) |
Amino Acid sequence : | |||
RMNLSDESISLSCQEHWNRAFTNCFLKVDAEIGGGDSHEPVAPETVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYERIEAAGGKVIQWNGHRVFGVLAMSRS IGDKYLKPWIIPDPEVTFIPRTKDDECLILASDGLWDVMTNEEVCDMARKRIRMWHK | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,782.348 | ||
Theoretical pI: | 5.516 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
Instability index: | 44.115 | ||
aromaticity | 0.062 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.226 | ||
sheet | 0.243 |