Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319927.1 | 3prime_partial | 103 | 309-1(-) |
Amino Acid sequence : | |||
MAEVKLLGLWYSPFSHRVEWALKIKGVEYEFIEEDLQNKSSLLLESNPIHKKIPVLIHRGKPICESMVILEYIDEAFEGPSILPKDPYERAMARFWAKFLEDK | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,090.972 | ||
Theoretical pI: | 5.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 42.192 | ||
aromaticity | 0.117 | ||
GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.194 | ||
sheet | 0.330 |