Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319937.1	internal	172	518-3(-)
Amino Acid sequence :
EYILVNGAVRKGERLMPPSALDLLLQVTFPAPSARVKATERFEAVYPTLKEVALAGSPGSKAMKQVSQQILLLAVKAVGGGNPELSREATDIFNWCLTQSTDCYKQWDKIYLDNIEASAA VLRKLTEGWKELSRRQSSLEVLKETLKSFRQKNEKSLTGGVDAHQLHFRDAD
Physicochemical properties
Number of amino acids:		172
Molecular weight:		19,132.700
Theoretical pI:		8.861
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22585
Instability index:		47.277
aromaticity		0.070
GRAVY		-0.340
Secondary Structure Fraction
Helix		0.297
turn		0.203
sheet		0.314