Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319945.1 | internal | 156 | 470-3(-) |
Amino Acid sequence : | |||
LPTESTQSQVVAHRMIYQNRVGFGSVNSGGKIPLGLKRKGLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLACPASPVHY KHNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSE | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,132.682 | ||
Theoretical pI: | 10.072 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 29.956 | ||
aromaticity | 0.064 | ||
GRAVY | -0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.256 | ||
sheet | 0.205 |