Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319948.1	internal	106	319-2(-)
Amino Acid sequence :
PIRVFKNSKDLGVKFPFDQPMKIYSSLWEADDWATRGGLEKIDWSKAPFIASYRGFHIGGCESSVNAKYCATQGKSWWDQKEFQDLDKTQWRLLRRVRDKYTIYNY
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,580.106
Theoretical pI:		9.289
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41940 42065
Instability index:		29.306
aromaticity		0.170
GRAVY		-0.770
Secondary Structure Fraction
Helix		0.321
turn		0.208
sheet		0.160