Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319952.1	internal	135	406-2(-)
Amino Acid sequence :
AKLNSSVLLWSITIALLLSFPVSHCNIGQGPKAVDQWFQKLSHANPKMTKLHFYFHDIVSGKNPTAVPVAWANSTSHSPTGFGQLAVLDDRLTTGPEINSTTIGRAQGIVGAASLDEFSL LMSLNFMFTNGKYSG
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,548.460
Theoretical pI:		8.874
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		21.042
aromaticity		0.096
GRAVY		0.076
Secondary Structure Fraction
Helix		0.319
turn		0.304
sheet		0.230