Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319953.1 | internal | 163 | 490-2(-) |
Amino Acid sequence : | |||
EKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVCINGMILKVISNG KLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,696.266 | ||
Theoretical pI: | 6.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 42.979 | ||
aromaticity | 0.043 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.264 | ||
sheet | 0.276 |