Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319956.1 | internal | 152 | 456-1(-) |
Amino Acid sequence : | |||
RGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSKFNQTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFV FASPKVGDLNFQKAFPKLKHLHILRIHNLLDI | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,920.101 | ||
Theoretical pI: | 6.317 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 36.193 | ||
aromaticity | 0.099 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.243 | ||
sheet | 0.250 |