Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319958.1 | complete | 111 | 2-337(+) |
Amino Acid sequence : | |||
MTVFDDELTEGHELNSGLVGKAQGFYISSSVDGTSQTMAFTVMFHSGSYSDSLSFFGVHRIKVSESHLAIMGGTGKYVNAKGFATVKTFPTVNQQTDGVETLLHVTVYLAN* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,946.239 | ||
Theoretical pI: | 5.591 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 22.030 | ||
aromaticity | 0.108 | ||
GRAVY | 0.023 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.261 | ||
sheet | 0.207 |