Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319959.1 | internal | 166 | 500-3(-) |
Amino Acid sequence : | |||
IIHRDVKSSNILLDSDFTAKIADFGLAKILEKKGELNTMSAVAGSFGYIAPEYAYTTKVNEKIDIYSFGVVLLELVTGRQPHFGEEHTSLAEWAWKQHGEGNNAINSMLDTDIKEACYLE EMKTVFRLGLICTSNLPASRPSMKEILQILHRCKSFRNSGGKSPDP | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,480.917 | ||
Theoretical pI: | 6.232 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 36.981 | ||
aromaticity | 0.084 | ||
GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.241 | ||
sheet | 0.271 |