Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319960.1 | 5prime_partial | 187 | 618-55(-) |
Amino Acid sequence : | |||
GSSNVEIEAVTCGPSHGISIGSLGVHHSQACVSNITVRNAIIRNSDNGVRIKTWQGGSGSVTGLSFDTIQMENVRNCIIIDQYYCMTKGCQNETSAVCVRDISYRNIKGTYDVRSPPIHF ACSDTIACTNITMSEVELLPHEGELVDDPFCWNAYGTQQTLTIPPIDCLRDGMPQSVGEAVEYTCNT* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,298.577 | ||
Theoretical pI: | 4.840 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20565 | ||
Instability index: | 47.014 | ||
aromaticity | 0.059 | ||
GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.283 | ||
sheet | 0.155 |