Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319969.1 | internal | 179 | 537-1(-) |
Amino Acid sequence : | |||
YRNPSADMLLTPDELNLDLIRSAKVFHYGSISLIVEPCRAAHLKAMEAAKEAGALLSYDPNLRLPLWPSAEEARTQIKSIWDKADVIKVSDVELEFLTGSDKIDDESAMSLWHPNLKLLL VTLGEKGCNYYTKKFHGSVEAFHVKTVDTTGAGDSFVGALLTKIVDDQAILGDEARLKE | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,773.345 | ||
Theoretical pI: | 5.138 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 15.391 | ||
aromaticity | 0.073 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.196 | ||
sheet | 0.324 |