Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319970.1 | 5prime_partial | 185 | 586-29(-) |
Amino Acid sequence : | |||
FEPPQLIEMAIALERSGVRFLWSIRRPVDAEPTKLEDILPEGFLERTKNRGIVCGWAPQVDILAHEATGAFVSHCGWNSTVESIWHGVPILTWPLYAEQHINGFQLVRDLEMAVELTLVY RMRESDHLEIVKAEEMEKAIRCIMDSENPLRKRVKDMGEICRNALMEGGSSSISIGRFVETILDS* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 13,597.685 | ||
Theoretical pI: | 9.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 50.136 | ||
aromaticity | 0.121 | ||
GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.241 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319970.1 | 5prime_partial | 116 | 2-352(+) |
Amino Acid sequence : | |||
ECKSLLFSILGIKNSFNESPYRNRRRSTLHQCVPANLSHVFDSLPQRIFTVHYASYSFLHLFCLHDFKMITLAHPVNQCQLHCHLKISDQLKPVDMLFCIKGPRQNWNSMPYTLYG* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,597.685 | ||
Theoretical pI: | 9.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 50.136 | ||
aromaticity | 0.121 | ||
GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.241 | ||
sheet | 0.198 |