Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319971.1 | 3prime_partial | 126 | 380-3(-) |
Amino Acid sequence : | |||
MYRAIHRREFQFPDWVSKPARRIINRLLDPNPDTRYGIEELMNTLWFKKSSSMKQEQSLKLFGEGILEKESEHMERMNAFDIISMSSGLDLSGLFEVGLNKTGMRFTTNVEVMKVEEKVM QIGKDE | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 12,707.412 | ||
Theoretical pI: | 7.026 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 48.716 | ||
aromaticity | 0.121 | ||
GRAVY | 0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.371 | ||
sheet | 0.103 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319971.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
PSSFPICITFSSTFITSTFVVNLIPVLFNPTSNKPDKSNPDDIEIISNAFILSICSLSFSKIPSPNSFKLCSCFIDDDFLNHKVFISSSIPYLVSGLGSRSRFIILRAGFDTQSGN* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,707.412 | ||
Theoretical pI: | 7.026 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 48.716 | ||
aromaticity | 0.121 | ||
GRAVY | 0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.371 | ||
sheet | 0.103 |