Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319973.1 | internal | 149 | 448-2(-) |
Amino Acid sequence : | |||
KMFIKLAILFVFLSIKFAPFIGAVDHVTPQESILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIHNANGAMPTFNINGVPLGTGLAGTTFAGGNNNNNNGQTL NTQLGPDGLGLGFGTITVIDDYLTSSPEL | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,596.622 | ||
Theoretical pI: | 5.375 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 44.565 | ||
aromaticity | 0.087 | ||
GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.349 | ||
sheet | 0.221 |