Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319975.1 | internal | 218 | 655-2(-) |
Amino Acid sequence : | |||
VATDEGKVSLGRRDIVVAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIA FNGINKTSEGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGID | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 24,237.290 | ||
Theoretical pI: | 6.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 34.163 | ||
aromaticity | 0.096 | ||
GRAVY | -0.167 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.248 | ||
sheet | 0.216 |