Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319976.1 | 5prime_partial | 157 | 512-39(-) |
Amino Acid sequence : | |||
IHSPTMAEVEADVAAGQQPKKRTFKKFSYRGVDLDALLDMSTDELVKLFPARPRRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEVVRTHLRNMIIVPEMIGSVIGIYNGKTFNQIEVK PEMISHYLAEFSISYKPVKYGRPGIGATHSSRFIPLK* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,885.883 | ||
Theoretical pI: | 10.306 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 43.773 | ||
aromaticity | 0.076 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.223 | ||
sheet | 0.242 |