Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319981.1 | internal | 148 | 446-3(-) |
Amino Acid sequence : | |||
ENMGLKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEK KTEDTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,816.009 | ||
Theoretical pI: | 5.904 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 18.197 | ||
aromaticity | 0.081 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.176 | ||
sheet | 0.203 |