Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319983.1 | 5prime_partial | 127 | 452-69(-) |
Amino Acid sequence : | |||
SFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKN CRKINSS* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,181.841 | ||
Theoretical pI: | 9.735 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 42.414 | ||
aromaticity | 0.102 | ||
GRAVY | -0.554 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.315 | ||
sheet | 0.213 |