Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319987.1 | internal | 122 | 368-3(-) |
Amino Acid sequence : | |||
SEKEKRLTVFHPEIEELLYSDVENDEHLCVLTDRNKPIIFTMARLDRVKNLTGLVEWYAKNPRLRELVNLVVVGGDRRKESKDLEEQAEMKKMYELIKTHNLNGQFRWISSQMNRVRNGE LY | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,547.509 | ||
Theoretical pI: | 6.820 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 45.211 | ||
aromaticity | 0.074 | ||
GRAVY | -0.734 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.180 | ||
sheet | 0.303 |