Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319992.1 | internal | 196 | 589-2(-) |
Amino Acid sequence : | |||
IQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFVFAS PKVGDLNFQKAFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGVD | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,855.601 | ||
Theoretical pI: | 6.136 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 35.785 | ||
aromaticity | 0.102 | ||
GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.255 | ||
sheet | 0.219 |