Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320000.1 | internal | 210 | 631-2(-) |
Amino Acid sequence : | |||
QQLPSNEPGALMHLVQNAAETDEDDPETRECKSLFKDIKFFLSREVPRESLLFVIPAFGGVVSWDGEGAPFKETDQSITHQIVDRPIQGHKFLSREYVQPQWIYDCVNARILLPVEEYVV GRIPPPHLSPFVDNEAEGYVPEYAETIKRLQAAARNEVLPMPGVGKEDLDDPQNLLVEGVIDRAEAIEAAEKQRKMSVLQKQYHDDLKKD | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 13,252.858 | ||
Theoretical pI: | 10.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 47.033 | ||
aromaticity | 0.108 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.198 | ||
sheet | 0.297 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320000.1 | complete | 111 | 438-103(-) |
Amino Acid sequence : | |||
MEKGHRLKRLTRVLLIRLSTGQFRATNSFPENMSSLSGFMIVLMHASFYQLRNMLWEGFLPHTCHLLLIMRPKVMFLNMQRPSSVSKQLQEMKCFQCRGWAKRIWMTLKIY* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 13,252.858 | ||
Theoretical pI: | 10.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 47.033 | ||
aromaticity | 0.108 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.198 | ||
sheet | 0.297 |