Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320017.1	internal	207	1-621(+)
Amino Acid sequence :
GTPIVFKSVQELANSNEVPEKYLHSQGSINTSPSLLYVPEVDLSLLTSPASPARQQELNKLQSGLKSCGCFQVINHGIADSFIDKVREISKQFFALPTEEKLKYARTVDDMEGYGNDSIL SEKQTLDWTDRLYLNVFPEDIRKLQFWPQKPECFREIFEEYIHNLKLLSVSLLKAMATSLNMDENCFLDQYGERGAMVARFNFYPPC
Physicochemical properties
Number of amino acids:		207
Molecular weight:		23,658.643
Theoretical pI:		5.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 23170
Instability index:		45.549
aromaticity		0.106
GRAVY		-0.349
Secondary Structure Fraction
Helix		0.324
turn		0.242
sheet		0.266