Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320029.1 | internal | 214 | 643-2(-) |
Amino Acid sequence : | |||
CNGNVNGNSHSNEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFE VSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,317.244 | ||
Theoretical pI: | 4.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 30.882 | ||
aromaticity | 0.112 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.266 | ||
sheet | 0.220 |