Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320033.1 | internal | 150 | 452-3(-) |
Amino Acid sequence : | |||
KGDNMGLKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLY EKKTEDTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,987.206 | ||
Theoretical pI: | 6.045 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 17.522 | ||
aromaticity | 0.080 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.180 | ||
sheet | 0.193 |