Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320039.1 | internal | 140 | 422-3(-) |
Amino Acid sequence : | |||
RKLQKMTLEKEQTEEMLKAREEMLKQKEEELEVRGKEHEKLQTELKKLQKMKEFKPTLNFSIVQSLTDKDEKKEKKKADSSKKRPVPPYLLWCKDHWDEVKKANPNAEFKEMGNLLGAKW KLISAEEKKPYEGKYQAEKE | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,736.210 | ||
Theoretical pI: | 9.174 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 39.149 | ||
aromaticity | 0.064 | ||
GRAVY | -1.391 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.136 | ||
sheet | 0.364 |