Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320053.1 | internal | 202 | 3-608(+) |
Amino Acid sequence : | |||
SLPKITSSKHIIDDETVKTKNFNKWKEACLSSFKVMDKDIKSLQELDCSCSGATAVVAIRQDDDLIIANLGDSRAILGRRTEEEVIEAVQLTTDLKPSLPSEAERIRKCDGRVLALKEEP HIQRVWLLHKDAPGLAMSRAFGDFMLKDYGIISKPDVSYHHISSNDQFIVLATDGVWDVLSNDDVVSIVDAANTAAAASEAV | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,208.955 | ||
Theoretical pI: | 5.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 47.791 | ||
aromaticity | 0.050 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.193 | ||
sheet | 0.262 |