Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320054.1 | internal | 159 | 479-3(-) |
Amino Acid sequence : | |||
DAGILLNDIPGRFQGEKSSPPNDNSVRGYEVIDEAKQRIKTMCPAASVSCADILALAARDSVAMLGGIPYPVRLGRSDARTANFTGALTQLPAPFDDLNVQLTKFRVKGMSAREMVALAG AHTVGFARCVTMCDDRNINPARKSTLNCGCPVNNNNTNL | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,967.209 | ||
Theoretical pI: | 8.615 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 33.897 | ||
aromaticity | 0.044 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.239 | ||
turn | 0.277 | ||
sheet | 0.258 |