Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320068.1 | 5prime_partial | 147 | 3-446(+) |
Amino Acid sequence : | |||
PPGQVTAQVVVEGMVYCQKCDEYGSWSLSGAKPIAAAKVSVICKNYMKRVSFYKAFQTDKNGYLFAQLDGFKMGHSYLDHPLHSCRAKLVDSPLENCDVFTNVNYGIIGARLRFLDKTVR RSNYEAVIYAAGPFAFRPAYCPPKPEY* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,477.799 | ||
Theoretical pI: | 9.023 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22265 | ||
Instability index: | 33.137 | ||
aromaticity | 0.136 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.238 | ||
sheet | 0.211 |