Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320080.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
SLNMEMLRDEILGNISLLLGLKRESLKEMHGEVKHAVRLNYYPPCPNPELVLGIGPHSDATSITLLLQDDDISGLQINHNQEWHPVDPIPNAILVNVGDCLEIWSNG | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,900.459 | ||
Theoretical pI: | 4.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 46.122 | ||
aromaticity | 0.037 | ||
GRAVY | -0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.299 | ||
sheet | 0.290 |