Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320091.1	internal	172	518-3(-)
Amino Acid sequence :
ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHIALFRSVLYWIAQLAGSVVACVLLKFSTGGLETSAFALSSGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGNLGIIAPIAIG FIVGANILAGGAFDGASMNPAVSFGPAVVSWTWKNHWIYWLGPFAGAAIAAL
Physicochemical properties
Number of amino acids:		172
Molecular weight:		11,825.727
Theoretical pI:		8.748
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25980
Instability index:		54.137
aromaticity		0.136
GRAVY		0.051
Secondary Structure Fraction
Helix		0.291
turn		0.262
sheet		0.078

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW320091.1	5prime_partial	103	516-205(-)
Amino Acid sequence :
IHSTCICPFCSSFSGSKHFGRTRKSCSYIWCFCGRSHCTFQKCFILDCTIGWIRCGLCAPQVFYGRIGNISIRPLKWSDTMERSCFRDSNDVWPCLHCLCNCS*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,825.727
Theoretical pI:		8.748
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 25980
Instability index:		54.137
aromaticity		0.136
GRAVY		0.051
Secondary Structure Fraction
Helix		0.291
turn		0.262
sheet		0.078