Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320103.1 | internal | 160 | 480-1(-) |
Amino Acid sequence : | |||
LRIKPMDDGNARCPMGPKYGALPEEVEPLLQAAHAARLTVSGVSFHIGSGDADSNAYLGAIAAAKEVFQTAAKFGMSKMTILDIGGGFTSGHQFTTAVTAIKSALSQHFPDETELTIIAE PGRYFAETAFTLATTIIGKRVRGELREYWINDGLYGSMNC | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,102.261 | ||
Theoretical pI: | 5.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 28.128 | ||
aromaticity | 0.088 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.231 | ||
sheet | 0.300 |