Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320107.1 | internal | 190 | 1-570(+) |
Amino Acid sequence : | |||
GEPKIQRGCSLGHLWTFFLKFAIGFLTSIFLRMETFLFTSESVNEGHPDKLCDQISDAVLDACPEQDPESKVACETCTKTNLVMVFGEITTKAVVDYEKIVRNTCRNIGFVSDDVGLDAD NCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKN | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 11,586.426 | ||
Theoretical pI: | 7.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 25.884 | ||
aromaticity | 0.048 | ||
GRAVY | 0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.210 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW320107.1 | complete | 105 | 426-109(-) |
Amino Acid sequence : | |||
MAMDTLSNIRTLLLNVNKDLAVVGIKTNIIRNESNITACVTYNLLIVYNSLGCDLTKDHDQVSLGASFTGNLAFRILLRAGIKNCIRDLITELVWVTLVHRLGGE* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,586.426 | ||
Theoretical pI: | 7.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 25.884 | ||
aromaticity | 0.048 | ||
GRAVY | 0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.210 | ||
sheet | 0.267 |